Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclic nucleotide-gated cation channel beta-1 (CNGB1), partial

Product Specifications

Product Name Alternative

Cyclic nucleotide-gated cation channel 4; CNG channel 4; CNG-4; CNG4; Cyclic nucleotide-gated cation channel gamma; Cyclic nucleotide-gated cation channel modulatory subunit; Cyclic nucleotide-gated channel beta-1; CNG channel beta-1; Glutamic acid-rich protein; GARP

Abbreviation

Recombinant Human CNGB1 protein, partial

Gene Name

CNGB1

UniProt

Q14028

Expression Region

1084-1178aa

Organism

Homo sapiens (Human)

Target Sequence

LRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELAALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Subunit of cyclic nucleotide-gated (CNG) channels, nonselective cation channels, which play important roles in both visual and olfactory signal transduction. When associated with CNGA1, it is involved in the regulation of ion flow into the rod photoreceptor outer segment (ROS), in response to light-induced alteration of the levels of intracellular cGMP.; Isoform GARP2 is a high affinity rod photoreceptor phosphodiesterase (PDE6) -binding protein that modulates its catalytic properties: it is a regulator of spontaneous activation of rod PDE6, thereby serving to lower rod photoreceptor 'dark noise' and allowing these sensory cells to operate at the single photon detection limit.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAMKL1 (DCLK1) (NM_004734) Human Tagged ORF Clone
RG217050 10 µg

DCAMKL1 (DCLK1) (NM_004734) Human Tagged ORF Clone

Sign In for Pricing
View Details
4- (2,4-Dichlorophenyl) -2-fluorophenol
428713-01 100 mg

4- (2,4-Dichlorophenyl) -2-fluorophenol

Sign In for Pricing
View Details
4- (2,4-Dichlorophenyl) -2-fluorophenol
428713-02 250 mg

4- (2,4-Dichlorophenyl) -2-fluorophenol

Sign In for Pricing
View Details
4- (2,4-Dichlorophenyl) -2-fluorophenol
428713-03 500 mg

4- (2,4-Dichlorophenyl) -2-fluorophenol

Sign In for Pricing
View Details
Collagen Type XXV, alpha 1 (COL25A1, CLAC)
C7510-98E 100 µg

Collagen Type XXV, alpha 1 (COL25A1, CLAC)

Sign In for Pricing
View Details
SPOP (Speckle Type POZ Protein) Rabbit ELISA Kit
H2902 96 Tests

SPOP (Speckle Type POZ Protein) Rabbit ELISA Kit

Sign In for Pricing
View Details