Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Hyaluronan synthase 2 (HAS2)

This Recombinant Chicken Hyaluronan synthase 2 (HAS2) spans the amino acid sequence from region 1-552.

Product Specifications

Product Name Alternative

Hyaluronan synthase 2, EC= 2.4.1.212, Hyaluronate synthase 2, Hyaluronic acid synthase 2, CHAS2, HA synthase 2

UniProt

O57424

Expression Region

1-552

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCERFICILRILGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAILASHLIIQ SLFAYLEHRKMKRSLETPIKLNKTVALCIAAYQEDPDYLRKCLLSVKRLTYPGIKVVMVI DGNSEDDVYMMDIFTEIMGRDKSATYIWSNNFHDKGPGETEESHRESMQHVSQLVLSNKS VCIMQKWGGKREVMYTAFKALGEAWNYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASFLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSIWFTILLGRVIFTIYKESKKPFSESKTTVLVIGTILYACYWVLLLTLYLVLITKCGRR KKEQHYDMVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-01 0.1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-02 0.2 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-03 0.5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-04 1 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-05 5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050435-06 5x 5 mL

APC-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details