Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663)

This Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663) spans the amino acid sequence from region 1-560.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter ATP-binding protein HI_0663

UniProt

P71355

Expression Region

1-560

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWNWVALVGGIISAVVFSYILQAAYFHELSLLSAVILGIVLIAALALRAFAGKKSVQAS YFASTKVKHELRSLIYRKLASMPLNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYS LLAPLTLFAFLIFFSFKTAIILLICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLD NLQGLITLKIYQDDAYKAKAMDKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILT ALLQFQNAQLSVLGVILFILLSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQ QSAVDFEAKNNVQVEIKDLHFSYSEEKPAITGLNLSILPNQLSVFVGKSGCGKSTLVSLL MGFNKAQQGEILFNGQNALNIDRTSFYQKVSLVSHSSYVFKGTLRENMTMAKIDATDEQI YACLEQVNLAQFVRDNGGLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNI DVESEEIILQFIQQFKQQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHKELMEKQGA YAEMFQQQKDLEQIREVANA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (2,2,2-Trifluoroethoxy) benzene-1-sulfonamide
UTB53697-01 50 mg

4- (2,2,2-Trifluoroethoxy) benzene-1-sulfonamide

Sign In for Pricing
View Details
4- (2,2,2-Trifluoroethoxy) benzene-1-sulfonamide
UTB53697-02 0.5 g

4- (2,2,2-Trifluoroethoxy) benzene-1-sulfonamide

Sign In for Pricing
View Details
Mouse Anti Pig IgG (H&L)-Alexa Fluor 568
MBS9526758-01 0.1 mL

Mouse Anti Pig IgG (H&L)-Alexa Fluor 568

Sign In for Pricing
View Details
Mouse Anti Pig IgG (H&L)-Alexa Fluor 568
MBS9526758-02 1 mL

Mouse Anti Pig IgG (H&L)-Alexa Fluor 568

Sign In for Pricing
View Details
Mouse Anti Pig IgG (H&L)-Alexa Fluor 568
MBS9526758-03 5x 1 mL

Mouse Anti Pig IgG (H&L)-Alexa Fluor 568

Sign In for Pricing
View Details
PRL3, CT (PTP4A3, PRL-3, PRL-R, Protein Tyrosine Phosphatase Type IVA, Member 3, Protein-tyrosine Phosphatase 4a3, Protein-tyrosine Phosphatase Of Regenerating Liver 3) (MaxLight 650) discontinued
P9109-48C2-ML650 100 µL

PRL3, CT (PTP4A3, PRL-3, PRL-R, Protein Tyrosine Phosphatase Type IVA, Member 3, Protein-tyrosine Phosphatase 4a3, Protein-tyrosine Phosphatase Of Regenerating Liver 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details