Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 37 (GPR37)

This Recombinant Human Probable G-protein coupled receptor 37 (GPR37) spans the amino acid sequence from region 27-613.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 37, Endothelin B receptor-like protein 1, ETBR-LP-1, Parkin-associated endothelin receptor-like receptor, PAELR

UniProt

O15354

Expression Region

27-613

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSW DLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFL QISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAG HEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMC LSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKK WLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVI WVGALLLALPEVVLRQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARLWWY FGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCII PENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAFMECCCC CCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPRL2 (F-3) Alexa Fluor® 790
sc-376986 AF790 200 µg/mL

NPRL2 (F-3) Alexa Fluor® 790

Sign In for Pricing
View Details
POU3F3, ID (POU3F3, BRN1, OTF8, POU domain, class 3, transcription factor 3, Brain-specific homeobox/POU domain protein 1, Octamer-binding protein 8, Octamer-binding transcription factor 8) (FITC) discontinued
040289-FITC 200 µL

POU3F3, ID (POU3F3, BRN1, OTF8, POU domain, class 3, transcription factor 3, Brain-specific homeobox/POU domain protein 1, Octamer-binding protein 8, Octamer-binding transcription factor 8) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)
MBS1333801-01 0.02 mg (E-Coli)

Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)
MBS1333801-02 0.02 mg (Yeast)

Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)
MBS1333801-03 0.1 mg (E-Coli)

Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)
MBS1333801-04 0.1 mg (Yeast)

Recombinant Legionella pneumophila Glutamyl-tRNA reductase (hemA)

Sign In for Pricing
View Details