Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dopamine receptor 3 (dop-3)

This Recombinant Dopamine receptor 3 (dop-3) spans the amino acid sequence from region 1-607.

Product Specifications

Product Name Alternative

Dopamine receptor 3

UniProt

Q6RYS9

Expression Region

1-607

Origin

Caenorhabditis elegans

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLI VSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECELANPYF NMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQ MGKHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPA IPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEE ILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSNDLPF SHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSD SMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLP FFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILS CGIFKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AFAP1L2 Antibody [Alexa Fluor 647]
NBP3-06316AF647 0.1 mL

Rabbit Polyclonal AFAP1L2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
CMAS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV678971 1.0 µg DNA

CMAS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lentiviral human DLX2 shRNA (UAS) - Lentiviral human DLX2 shRNA (UAS, RFP) plasmid
GTR15347812 1 Vial

Lentiviral human DLX2 shRNA (UAS) - Lentiviral human DLX2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
HAUS6 Polyclonal Conjugated Antibody
orb1619024 100 µL

HAUS6 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MTT Assay Reagent, Ready-to-use,1000 assays
M0200-010 10x 1 mL

MTT Assay Reagent, Ready-to-use,1000 assays

Sign In for Pricing
View Details
MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)
324481-01 50 µg

MSH3 (Divergent Upstream Protein, DNA Mismatch Repair Protein, DNA Mismatch Repair Protein Msh 3, DNA Mismatch Repair Protein Msh3, DUC 1, DUC1, DUG, DUP, HMSH3, Mismatch Repair Protein 1, MRP 1, MRP1, MSH 3, MSH3_HUMAN, MutS Homolog 3 (E. coli), MutS Homolog 3)

Sign In for Pricing
View Details