Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus V-type ATP synthase subunit I (atpI)

This Recombinant Methanothermobacter thermautotrophicus V-type ATP synthase subunit I (atpI) spans the amino acid sequence from region 1-658.

Product Specifications

Product Name Alternative

V-type ATP synthase subunit I, V-ATPase subunit I

UniProt

O27041

Expression Region

1-658

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMFLPARMRKLKIITLDQYSDSVVRSLHEEGVTQIDDISERIQQDAEWRQILKPSRAT PYTGRVSSLLMKTSGILDFLGSVAAEEKGLRDTIREFINPPIFEKREVEELDTESLIERA EETLGRVESETRVMEEKLNELDSERSAVESSLSVAEKLKDFDIDFSDLQDSEYITGIAGR ITAENLPELRDKLADITDELVISDREGENKAERILIIVTLKKHADSIASVLRRMEFERFE ISELQGRPSEIISSSKTRLEEISRERKEIISKLRDINAEWEDELLVLREQLEIEKERNEV FSLFGETRKTVMLEAWVPLKEADRVIAVVEESSEGTALTDLEDPDPEEVPVLLDNPRFAK PYETFVEMYSPLKYNEIDPTIFMAFVFPFFFGFCLTDAGYGIIDALIGFILYRGLGKVNN FMRNFGIIMMSCGVWAFILGMVTNGFIGDFFPRFFNITLPTVIPAIDAFVNPQNILIMAL TVGVLHINFGLILGARNNIRLGNMREALGSQIVWLILELGIILYLVGGMIFGAPLIILAF AMLLYYNGLFGLMDVSGFLGTLLSYARLLALCLSTGGIAMTVNILTGLSYEMIPVIGVVL APIIFVFGHIANNAFQSLGAFINSLRLHYVEFFAQFYMGGKNKFNAFRAERNFTKIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC)
126896-FITC 100 µL

Flt3 Ligand (Fms-like Tyrosine Kinase 3 Ligand, FL, flk2 Ligand, Fms Related Tyrosine Kinase 3 Ligand, Flt3-L, Flt 3L, Flt3 L, FLT3 LG, Flt3L, FLT3LG, SL Cytokine) (FITC)

Sign In for Pricing
View Details
CETN1-set siRNA/shRNA/RNAi Lentivector (Human)
15960091 4x 500 ng

CETN1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ALAS-E Rabbit Polyclonal Antibody (AP)
orb878466 100 µL

ALAS-E Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Neddylin Polyclonal Antibody
UB-GEN-2656 100 µL

Neddylin Polyclonal Antibody

Sign In for Pricing
View Details
RFFL (NM_057178) Human Tagged ORF Clone
RC212645 10 µg

RFFL (NM_057178) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ezh2 Inhibitor II, EI1 (Enhancer of Zested Homolog 2 Inhibitor II, HMTase Inhibitor XI, 6-Cyano-N- ((4,6-dimethyl-2-oxo-1,2-dihydropyridin-3-yl) methyl) -1- (pentan-3-yl) -1H-indole-4-carboxamide)
217349 10 mg

Ezh2 Inhibitor II, EI1 (Enhancer of Zested Homolog 2 Inhibitor II, HMTase Inhibitor XI, 6-Cyano-N- ((4,6-dimethyl-2-oxo-1,2-dihydropyridin-3-yl) methyl) -1- (pentan-3-yl) -1H-indole-4-carboxamide)

Sign In for Pricing
View Details