Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus weihenstephanensis Potassium-transporting ATPase B chain (kdpB)

This Recombinant Bacillus weihenstephanensis Potassium-transporting ATPase B chain (kdpB) spans the amino acid sequence from region 1-697.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase B chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] B chain, Potassium-binding and translocating subunit B, Potassium-translocating ATPase B chain

UniProt

A9VFM1

Expression Region

1-697

Origin

Bacillus weihenstephanensis (strain KBAB4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRPVVVKEKRVNESQIHAVEDEVRQAKTMDRDIVTHAMKQSFAKLNPKVMIKNPIMFVV EIGFIITLILSFLPSSSSSVPGWFNITVSLILLFTVLFANFAEALAEGRGKAQADSLKQS KKDVFANVVKENGDIVQVSATDLRKGDIVIVKQGEMIPNDGEVIKGLASVDESAITGESA PVIKEAGGDFCSVTGGTMVVSDEITIVITSNPGESFIDKMISLVEGAARQKTPNEIALNT VLTSLTLIFLIVVVTLPIFTNYLGFQIDTAVLVALLVCLIPTTIGGLLSAIGIAGMDRVT KFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWAAISSVL DETPEGRSVIEYVQTKSISYNREIAEQGEFVPFKAETRMSGVDLQDGTKVRKGAVGAVIE WVQSQGGMIPKDVNQKADLISKEGGTPLVVAVDNRIYGLIYLKDTVKPGMRERFEQLRQM GIKTVMCTGDNPLTAATIAKEAGVDEFVAECKPEDKIAVIKAEQDKGKLVAMTGDGTNDA PALAQADVGLAMNSGTTAAKEAANMIDLDSNPTKIIEVVGIGKQLLMTRGALTTFSIAND IAKYFAIIPAMFTLAIPQMEALNIMKLTSPLSAILSALIFNAVIIPLLIPLAMKGIAYKP MSSNALLSRNLLIYGLGGVIVPFIGIKVIDMIVGLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCED1A Antibody, HRP conjugated
A67569-50UG 50 µg

PCED1A Antibody, HRP conjugated

Sign In for Pricing
View Details
PLV3-U6-YAP1-shRNA2-mCherry-Puro Plasmid
PVT76168 2 µg

PLV3-U6-YAP1-shRNA2-mCherry-Puro Plasmid

Sign In for Pricing
View Details
WASH RESERVOIR, Slots for 13 Anti-Splash Baffles, Guide Pins for Blotting Station (Protrudes 1.5mm), Two Inlet/Outlet Ports on the Long Side, Opposite Position, High and Low, 234mL Max Capacity, 32mm Height, 25mm Chamber Depth, Blot Paper Support Compatible (VP 540B1), SLAS Footprint, Polypropylene, Autoclavable
VP 540T-A 1 EACH

WASH RESERVOIR, Slots for 13 Anti-Splash Baffles, Guide Pins for Blotting Station (Protrudes 1.5mm), Two Inlet/Outlet Ports on the Long Side, Opposite Position, High and Low, 234mL Max Capacity, 32mm Height, 25mm Chamber Depth, Blot Paper Support Compatible (VP 540B1), SLAS Footprint, Polypropylene, Autoclavable

Sign In for Pricing
View Details
Rat Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069137-01 48 Well

Rat Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details
Rat Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069137-02 96 Well

Rat Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details
Rat Kruppel Like Factor 5, Intestinal ELISA Kit
MBS069137-03 5x 96 Well

Rat Kruppel Like Factor 5, Intestinal ELISA Kit

Sign In for Pricing
View Details