Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat FXYD domain-containing ion transport regulator 3 (Fxyd3)

This Recombinant Rat FXYD domain-containing ion transport regulator 3 (Fxyd3) spans the amino acid sequence from region 21-88.

Product Specifications

Product Name Alternative

FXYD domain-containing ion transport regulator 3

UniProt

P59645

Expression Region

21-88

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NDPEDKDSPFYYDWHSLRVGGLICAGILCALGIIVLMSGKCKCKFSQKPSHRPGDGPPLITPGSAHNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-100 1x 100 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF405S conjugate, 0.1mg/mL
BNC042559-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL
BNC740842-100 1x 100 µL

MUC2 (MLP/842), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF740 conjugate, 0.1mg/mL
BNC740902-100 1x 100 µL

Nucleolin (NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details