Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase protein 8 (MT-ATP8)

This Recombinant Human ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

P03928

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL
BNC740563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF647 conjugate, 0.1mg/mL
BNC470810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF740 conjugate, 0.1mg/mL
BNC740752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details