Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase protein 8 (MT-ATP8)

This Recombinant Human ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

P03928

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Etiracetam Carboxylic Acid
TRC-E932960-25MG 25 mg

Etiracetam Carboxylic Acid

Sign In for Pricing
View Details
Human CC2D2A activation kit by CRISPRa
GA111577 1 Kit

Human CC2D2A activation kit by CRISPRa

Sign In for Pricing
View Details
IGFL2 (NM_001135113) Human Over-expression Lysate
LY427558 100 µg

IGFL2 (NM_001135113) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin B (CTSB) (NM_001908) Human Recombinant Protein
TP720340L 500 µg

Cathepsin B (CTSB) (NM_001908) Human Recombinant Protein

Sign In for Pricing
View Details
Folylpolyglutamate synthase (FPGS) Rabbit Polyclonal Antibody
AP17399PU-N 400 µL

Folylpolyglutamate synthase (FPGS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details