Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase protein 8 (MT-ATP8)

This Recombinant Human ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

P03928

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1, Mouse (RMP1-14), 1mg/mL
BNUM2002-50 1x 50 µL

PD1, Mouse (RMP1-14), 1mg/mL

Sign In for Pricing
View Details
SLC9A3R2 (Isoform b) Goat Polyclonal Antibody
AP31560PU-N 100 µg

SLC9A3R2 (Isoform b) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CDA Rabbit Polyclonal Antibody
TA374495 100 µL

CDA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 0.2mg/mL
BNUB2587-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 0.2mg/mL

Sign In for Pricing
View Details
KIRREL2 Human qPCR Primer Pair (NM_199180)
HP229743 200 Reactions

KIRREL2 Human qPCR Primer Pair (NM_199180)

Sign In for Pricing
View Details
IP3KA Antibody
8C10462-AAT 50 µg

IP3KA Antibody

Sign In for Pricing
View Details