Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ceratotherium simum ATP synthase protein 8 (MT-ATP8)

This Recombinant Ceratotherium simum ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

O03199

Expression Region

1-68

Origin

Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLDTSTWSITIVSMIITLFIMFQLKLSKYSYPSSPELKLTKTPTHTTPWESKWTKTYLPLSLPQQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF405S conjugate, 0.1mg/mL
BNC041927-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741175-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF594 conjugate, 0.1mg/mL
BNC942217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details