Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8)

This Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

P92663

Expression Region

1-69

Origin

Macropus robustus (Wallaroo) (Euro)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLDTSTWLLTITLMILALFCIYQSKMINQTMISIPPQDKKVIKPTTQLPWESKWTKIYLPHSSPLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL
BNC470918-100 1x 100 µL

CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9,10-Dehydro Folitixorin-(phenylene-d4) Chloride
TRC-D229707-1MG 1 mg

9,10-Dehydro Folitixorin-(phenylene-d4) Chloride

Sign In for Pricing
View Details
Vacuum Oven BOVA-5904
BOVA-5904 1 Unit

Vacuum Oven BOVA-5904

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF740 conjugate, 0.1mg/mL
BNC740334-100 1x 100 µL

Cytokeratin 8 (H1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  5nm
GAF-451-5 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 5nm

Sign In for Pricing
View Details
DCL 1 (CD302) (NM_001198763) Human Over-expression Lysate
LC434014 20 µg

DCL 1 (CD302) (NM_001198763) Human Over-expression Lysate

Sign In for Pricing
View Details