Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8)

This Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

ATP synthase protein 8, A6L, F-ATPase subunit 8

UniProt

P92663

Expression Region

1-69

Origin

Macropus robustus (Wallaroo) (Euro)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLDTSTWLLTITLMILALFCIYQSKMINQTMISIPPQDKKVIKPTTQLPWESKWTKIYLPHSSPLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC63 activation kit by CRISPRa
GA116009 1 Kit

Human CCDC63 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM13C Antibody (Biotin)
KB-3717-01 50 μL

FAM13C Antibody (Biotin)

Sign In for Pricing
View Details
FAM13C Antibody (Biotin)
KB-3717-02 100 µL

FAM13C Antibody (Biotin)

Sign In for Pricing
View Details
FAM13C Antibody (Biotin)
KB-3717-03 1 mL

FAM13C Antibody (Biotin)

Sign In for Pricing
View Details
KLF12 Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF810315 100 µg

KLF12 Mouse Monoclonal Antibody [Clone ID: OTI3D4]

Sign In for Pricing
View Details
Cds1 Mouse Gene Knockout Kit (CRISPR)
KN503075 1 Kit

Cds1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details