Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8)
This Recombinant Macropus robustus ATP synthase protein 8 (MT-ATP8) spans the amino acid sequence from region 1-69.
Product Specifications
Product Name Alternative
ATP synthase protein 8, A6L, F-ATPase subunit 8
UniProt
P92663
Expression Region
1-69
Origin
Macropus robustus (Wallaroo) (Euro)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPQLDTSTWLLTITLMILALFCIYQSKMINQTMISIPPQDKKVIKPTTQLPWESKWTKIYLPHSSPLLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN200758RB 1 Kit
Signal Peptide Peptidase (HM13) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
