Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Phospholemman (FXYD1)

This Recombinant Dog Phospholemman (FXYD1) spans the amino acid sequence from region 21-92.

Product Specifications

Product Name Alternative

Phospholemman, FXYD domain-containing ion transport regulator 1

UniProt

P56513

Expression Region

21-92

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX17 Recombinant Protein (Mouse)
RP128345 100 µg

DDX17 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
IGHEP2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1031304 1.0 µg DNA

IGHEP2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Chloramphenicol sodium succinate
412839 5.0g

Chloramphenicol sodium succinate

Sign In for Pricing
View Details
Genorise® recombinant Mouse LPL protein
GR124177 5 µg

Genorise® recombinant Mouse LPL protein

Sign In for Pricing
View Details
VIP Receptor 1 (VIPR1) Rabbit Polyclonal Antibody
AP10557PU-N 100 µg

VIP Receptor 1 (VIPR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFSF11 AAV siRNA Pooled Vector
47222161 1.0 µg

TNFSF11 AAV siRNA Pooled Vector

Sign In for Pricing
View Details