Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Phospholemman (FXYD1)

This Recombinant Dog Phospholemman (FXYD1) spans the amino acid sequence from region 21-92.

Product Specifications

Product Name Alternative

Phospholemman, FXYD domain-containing ion transport regulator 1

UniProt

P56513

Expression Region

21-92

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL12A (NM_000882) Human Recombinant Protein
TP721240M 50 µg

IL12A (NM_000882) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-ACE2 Antibody Picoband® (Biotine Conjugate)
A00756-4-Biotin 100 µg/Vial

Anti-ACE2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Ku, p70, p80 (BSA & Azide Free) (APC)
MBS6266124-01 0.1 mL

Ku, p70, p80 (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
Ku, p70, p80 (BSA & Azide Free) (APC)
MBS6266124-02 5x 0.1 mL

Ku, p70, p80 (BSA & Azide Free) (APC)

Sign In for Pricing
View Details
PAOX rabbit pAb
ES3828-01 50 µL

PAOX rabbit pAb

Sign In for Pricing
View Details
PAOX rabbit pAb
ES3828-02 100 µL

PAOX rabbit pAb

Sign In for Pricing
View Details