Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholemman (FXYD1)

This Recombinant Human Phospholemman (FXYD1) spans the amino acid sequence from region 21-92.

Product Specifications

Product Name Alternative

Phospholemman, FXYD domain-containing ion transport regulator 1

UniProt

O00168

Expression Region

21-92

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enteropeptidase (TMPRSS15) Antibody
abx323146-01 50 µg

Enteropeptidase (TMPRSS15) Antibody

Sign In for Pricing
View Details
Enteropeptidase (TMPRSS15) Antibody
abx323146-02 100 µg

Enteropeptidase (TMPRSS15) Antibody

Sign In for Pricing
View Details
EVI2A (Ecotropic Viral Integration Site 2A)
480447 100 µL

EVI2A (Ecotropic Viral Integration Site 2A)

Sign In for Pricing
View Details
ALDH3B2 Antibody, FITC conjugated
A12401-50UG 50 µg

ALDH3B2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human Carbonic anhydrase related protein 10 (CA10) ELISA Kit
MBS7248863-01 48 Well

Human Carbonic anhydrase related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic anhydrase related protein 10 (CA10) ELISA Kit
MBS7248863-02 96 Well

Human Carbonic anhydrase related protein 10 (CA10) ELISA Kit

Sign In for Pricing
View Details