Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholemman (FXYD1)

This Recombinant Human Phospholemman (FXYD1) spans the amino acid sequence from region 21-92.

Product Specifications

Product Name Alternative

Phospholemman, FXYD domain-containing ion transport regulator 1

UniProt

O00168

Expression Region

21-92

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IRAK1 (Thr209) Rabbit Polyclonal Antibody (Biotin)
orb501488 100 µL

Phospho-IRAK1 (Thr209) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
8-Methoxy loxapine
282106-01 2 mg

8-Methoxy loxapine

Sign In for Pricing
View Details
8-Methoxy loxapine
282106-02 5 mg

8-Methoxy loxapine

Sign In for Pricing
View Details
8-Methoxy loxapine
282106-03 10 mg

8-Methoxy loxapine

Sign In for Pricing
View Details
8-Methoxy loxapine
282106-04 25 mg

8-Methoxy loxapine

Sign In for Pricing
View Details
8-Methoxy loxapine
282106-05 50 mg

8-Methoxy loxapine

Sign In for Pricing
View Details