Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stannin (Snn)

This Recombinant Mouse Stannin (Snn) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Stannin

UniProt

P61807

Expression Region

1-88

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metal Fluor™ Zn-520, AM
21263-AAT 1 mg

Metal Fluor™ Zn-520, AM

Sign In for Pricing
View Details
N-Nitroso Apraclonidine (Possibility-2)
CS-O-58978 1 Each

N-Nitroso Apraclonidine (Possibility-2)

Sign In for Pricing
View Details
Btrc 3'UTR GFP Stable Cell Line
TU152898 1.0 mL

Btrc 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Alexa Fluor® 700 Mouse IgG1, κ Isotype Ctrl (ICFC)
GT16969 25 Tests

Alexa Fluor® 700 Mouse IgG1, κ Isotype Ctrl (ICFC)

Sign In for Pricing
View Details
Idh3B Rat shRNA Plasmid (Locus ID 94173)
TL711981 1 Kit

Idh3B Rat shRNA Plasmid (Locus ID 94173)

Sign In for Pricing
View Details
Tlr2 Antibody (FITC)
orb1271314 0.025 mg

Tlr2 Antibody (FITC)

Sign In for Pricing
View Details