Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Stannin (Snn)

This Recombinant Rat Stannin (Snn) spans the amino acid sequence from region 1-88.

Product Specifications

Product Name Alternative

Stannin

UniProt

P61808

Expression Region

1-88

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF8 Antibody
orb522140-01 50 μL

FGF8 Antibody

Sign In for Pricing
View Details
FGF8 Antibody
orb522140-02 100 µL

FGF8 Antibody

Sign In for Pricing
View Details
HEPACAM2 Antibody
OACA03101-50UG 50 µg

HEPACAM2 Antibody

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit K (nuoK)
MBS1158728 Inquire

Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
SPZ1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV656719 1.0 µg DNA

SPZ1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Manganese selenide 99.9%
M01990-01 1 g

Manganese selenide 99.9%

Sign In for Pricing
View Details