Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein transport protein Sec61 subunit beta (SEC61B)

This Recombinant Human Protein transport protein Sec61 subunit beta (SEC61B) spans the amino acid sequence from region 2-96.

Product Specifications

Product Name Alternative

Protein transport protein Sec61 subunit beta

UniProt

P60468

Expression Region

2-96

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCF 101
M27484-01 1 g

UCF 101

Sign In for Pricing
View Details
UCF 101
M27484-02 200 mg

UCF 101

Sign In for Pricing
View Details
UCF 101
M27484-03 500 mg

UCF 101

Sign In for Pricing
View Details
UCF 101
M27484-04 2 mg

UCF 101

Sign In for Pricing
View Details
UCF 101
M27484-05 5 mg

UCF 101

Sign In for Pricing
View Details
UCF 101
M27484-06 10 mg

UCF 101

Sign In for Pricing
View Details