Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig 5-hydroxytryptamine receptor 2B (HTR2B)

This Recombinant Guinea pig 5-hydroxytryptamine receptor 2B (HTR2B) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2B, 5-HT-2B, 5-HT2B, Serotonin receptor 2B

UniProt

P97267

Expression Region

1-96

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 9 (CASP9) (1-250) Mouse Monoclonal Antibody [Clone ID: 5B4]
AM26603AF-N 100 µg

Caspase 9 (CASP9) (1-250) Mouse Monoclonal Antibody [Clone ID: 5B4]

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2505), 0.2mg/mL
BNUB2505-500 1x 500 µL

CD73 (Immuno-Oncology Target) (NT5E/2505), 0.2mg/mL

Sign In for Pricing
View Details
4-(4-Bromo-3-formylphenoxy)benzonitrile
TRC-B700800-50MG 50 mg

4-(4-Bromo-3-formylphenoxy)benzonitrile

Sign In for Pricing
View Details
TTC39B Human Gene Knockout Kit (CRISPR)
KN423149 1 Kit

TTC39B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRIA1 Rabbit Monoclonal Antibody
TA422719 100 µL

GRIA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PRPS2 (NM_002765) Human Over-expression Lysate
LY419123 100 µg

PRPS2 (NM_002765) Human Over-expression Lysate

Sign In for Pricing
View Details