Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig 5-hydroxytryptamine receptor 2B (HTR2B)

This Recombinant Guinea pig 5-hydroxytryptamine receptor 2B (HTR2B) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 2B, 5-HT-2B, 5-HT2B, Serotonin receptor 2B

UniProt

P97267

Expression Region

1-96

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CCL4 Antibody
RC-16129-01 50 μL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
Recombinant CCL4 Antibody
RC-16129-02 100 µL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
Recombinant CCL4 Antibody
RC-16129-03 1 mL

Recombinant CCL4 Antibody

Sign In for Pricing
View Details
Aluminum Potassium Sulfate Dodecahydrate
TRC-A576048-5G 5 g

Aluminum Potassium Sulfate Dodecahydrate

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M1-01 20 Tests

Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M1-02 100 Tests

Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details