Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Human Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein, Protein B144

UniProt

O00453

Expression Region

1-97

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ruthenium hexammine trichloride
17253-1 1 g

Ruthenium hexammine trichloride

Sign In for Pricing
View Details
Recombinant Anti-C1D Antibody, Rabbit Monoclonal
MBS8106428-01 0.1 mL

Recombinant Anti-C1D Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-C1D Antibody, Rabbit Monoclonal
MBS8106428-02 5x 0.1 mL

Recombinant Anti-C1D Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Kif2c Rat shRNA Lentiviral Particle (Locus ID 171529)
TL704037V 500 µL Each

Kif2c Rat shRNA Lentiviral Particle (Locus ID 171529)

Sign In for Pricing
View Details
ZNF331 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2700305 3x 1.0 µg

ZNF331 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SAPCD1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV747787 1.0 µg DNA

SAPCD1-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details