Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte-specific transcript 1 protein (LST1)

This Recombinant Human Leukocyte-specific transcript 1 protein (LST1) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Leukocyte-specific transcript 1 protein, Protein B144

UniProt

O00453

Expression Region

1-97

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fut4 (NM_022219) Rat Tagged ORF Clone Lentiviral Particle
RR213948L4V 200 µL

Fut4 (NM_022219) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PPP3CC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-19973R-BF594 100 µL

PPP3CC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ATP6V0B Rabbit Polyclonal Antibody
TA335996 100 µL

ATP6V0B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPS14P10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV783231 1.0 µg DNA

RPS14P10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
GluR-δ2 (h) -PR
sc-42491-PR 10 µM - 20 µL

GluR-δ2 (h) -PR

Sign In for Pricing
View Details
Mouse Monoclonal CRYZL1 Antibody (OTI2F9) [mFluor Violet 610 SE]
NBP2-71522MFV610 0.1 mL

Mouse Monoclonal CRYZL1 Antibody (OTI2F9) [mFluor Violet 610 SE]

Sign In for Pricing
View Details