Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-2 (Upk2)

This Recombinant Mouse Uroplakin-2 (Upk2) spans the amino acid sequence from region 85-184.

Product Specifications

Product Name Alternative

Uroplakin-2 UP2 Uroplakin II UPII

UniProt

P38575

Expression Region

85-184

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticam2 (NM_001108890) Rat Tagged ORF Clone Lentiviral Particle
RR208564L3V 200 µL

Ticam2 (NM_001108890) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (Biotin) discontinued
032125-Biotin 200 µL

ASB2, NT (ASB2, Ankyrin repeat and SOCS box protein 2) (Biotin) discontinued

Sign In for Pricing
View Details
GSTM2 (NM_001142368) Human Tagged Lenti ORF Clone
RC227321L4 10 µg

GSTM2 (NM_001142368) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine Cytochrome b5 ELISA Kit
MBS755333-01 48 Well

Bovine Cytochrome b5 ELISA Kit

Sign In for Pricing
View Details
Bovine Cytochrome b5 ELISA Kit
MBS755333-02 96 Well

Bovine Cytochrome b5 ELISA Kit

Sign In for Pricing
View Details
Bovine Cytochrome b5 ELISA Kit
MBS755333-03 5x 96 Well

Bovine Cytochrome b5 ELISA Kit

Sign In for Pricing
View Details