Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-2 (Upk2)

This Recombinant Mouse Uroplakin-2 (Upk2) spans the amino acid sequence from region 85-184.

Product Specifications

Product Name Alternative

Uroplakin-2 UP2 Uroplakin II UPII

UniProt

P38575

Expression Region

85-184

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HARS2 (Probable Histidine--tRNA Ligase, Mitochondrial, Histidyl-tRNA Synthetase 2)
482529 100 µL

HARS2 (Probable Histidine--tRNA Ligase, Mitochondrial, Histidyl-tRNA Synthetase 2)

Sign In for Pricing
View Details
GloMeltTM Thermal Shift Protein Stability Kit with ROX
#33022-T 1 Kit

GloMeltTM Thermal Shift Protein Stability Kit with ROX

Sign In for Pricing
View Details
FANCI siRNA (h)
sc-90074 10 µM

FANCI siRNA (h)

Sign In for Pricing
View Details
Mitogen-Activated Protein Kinase Kinase Kinase 8 (MAP3K8) Rat ELISA Kit
F0512 96 Tests

Mitogen-Activated Protein Kinase Kinase Kinase 8 (MAP3K8) Rat ELISA Kit

Sign In for Pricing
View Details
eEF1A2 Antibody
MBS8504964-01 0.1 mL

eEF1A2 Antibody

Sign In for Pricing
View Details
eEF1A2 Antibody
MBS8504964-02 0.1 mL (AF405L)

eEF1A2 Antibody

Sign In for Pricing
View Details