Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-2 (Upk2)

This Recombinant Mouse Uroplakin-2 (Upk2) spans the amino acid sequence from region 85-184.

Product Specifications

Product Name Alternative

Uroplakin-2 UP2 Uroplakin II UPII

UniProt

P38575

Expression Region

85-184

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Extl3 Rat shRNA Lentiviral Particle (Locus ID 56819)
TL710409V 500 µL Each

Extl3 Rat shRNA Lentiviral Particle (Locus ID 56819)

Sign In for Pricing
View Details
(2,4-Difluorophenyl) (3-methanesulfonylphenyl) methanone
WTB97174-01 50 mg

(2,4-Difluorophenyl) (3-methanesulfonylphenyl) methanone

Sign In for Pricing
View Details
(2,4-Difluorophenyl) (3-methanesulfonylphenyl) methanone
WTB97174-02 0.5 g

(2,4-Difluorophenyl) (3-methanesulfonylphenyl) methanone

Sign In for Pricing
View Details
α-protein kinase 1 CRISPR Activation Plasmid (m2)
sc-427962-ACT-2 20 µg

α-protein kinase 1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Pig S100 calcium binding protein ELISA Kit
GTR10479314-01 48 Well

Pig S100 calcium binding protein ELISA Kit

Sign In for Pricing
View Details
Pig S100 calcium binding protein ELISA Kit
GTR10479314-02 96 Well

Pig S100 calcium binding protein ELISA Kit

Sign In for Pricing
View Details