Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell cycle control protein 50C (TMEM30C)

This Recombinant Human Cell cycle control protein 50C (TMEM30C) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Cell cycle control protein 50C, Transmembrane protein 30C

UniProt

A0ZSE6

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Complement Factor D Antibody (Lampalizumab)
F1353-1 1 mg

Anti-Complement Factor D Antibody (Lampalizumab)

Sign In for Pricing
View Details
OZONE450X52CARD-T1-P2 Pipe Markers for Gases
N002628 2 Card (2 Marker (s) x 1 Card)

OZONE450X52CARD-T1-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
NASP  Polyclonal Antibody
MBS2538617-01 0.06 mL

NASP Polyclonal Antibody

Sign In for Pricing
View Details
NASP  Polyclonal Antibody
MBS2538617-02 0.12 mL

NASP Polyclonal Antibody

Sign In for Pricing
View Details
NASP  Polyclonal Antibody
MBS2538617-03 0.2 mL

NASP Polyclonal Antibody

Sign In for Pricing
View Details
NASP  Polyclonal Antibody
MBS2538617-04 5x 0.2 mL

NASP Polyclonal Antibody

Sign In for Pricing
View Details