Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2)

This Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2) spans the amino acid sequence from region 2-116.

Product Specifications

Product Name Alternative

Vesicle-associated membrane protein 2, VAMP-2, Synaptobrevin-2

UniProt

P63044

Expression Region

2-116

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELL Mouse Monoclonal Antibody [Clone ID: OTI1G2]
CF810843 100 µg

ELL Mouse Monoclonal Antibody [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Human TUG (ASPSCR1) activation kit by CRISPRa
GA112340 1 Kit

Human TUG (ASPSCR1) activation kit by CRISPRa

Sign In for Pricing
View Details
ACE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G4] (Angiotensin Converting Enzyme 2)
TA804152AM 100 µL

ACE2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G4] (Angiotensin Converting Enzyme 2)

Sign In for Pricing
View Details
Recombinant SAE1 Antibody
RC-15859-01 50 μL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details
Recombinant SAE1 Antibody
RC-15859-02 100 µL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details
Recombinant SAE1 Antibody
RC-15859-03 1 mL

Recombinant SAE1 Antibody

Sign In for Pricing
View Details