Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2)

This Recombinant Mouse Vesicle-associated membrane protein 2 (Vamp2) spans the amino acid sequence from region 2-116.

Product Specifications

Product Name Alternative

Vesicle-associated membrane protein 2, VAMP-2, Synaptobrevin-2

UniProt

P63044

Expression Region

2-116

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER3 (NM_004838) Human Recombinant Protein
TP304168 20 µg

HOMER3 (NM_004838) Human Recombinant Protein

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-1102
BMET-1102 1 Unit

Multi-parameter Analyzer BMET-1102

Sign In for Pricing
View Details
SIRT6-IN-1
TRC-S487908-50MG 50 mg

SIRT6-IN-1

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), 0.2mg/mL
BNUB3813-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), 0.2mg/mL

Sign In for Pricing
View Details
Tretazicar (>94%)
TRC-T719800-50MG 50 mg

Tretazicar (>94%)

Sign In for Pricing
View Details
PIGY (NM_001042616) Human Over-expression Lysate
LC421007 20 µg

PIGY (NM_001042616) Human Over-expression Lysate

Sign In for Pricing
View Details