Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Putative phosphotransferase enzyme IIB component MPN_268 (MPN_268)

This Recombinant Mycoplasma pneumoniae Putative phosphotransferase enzyme IIB component MPN_268 (MPN_268) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Putative phosphotransferase enzyme IIB component MPN_268, EC= 2.7.1.69, Putative PTS system EIIB component

UniProt

P75507

Expression Region

1-117

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVLLWIGYVLSFGLLYLYLVKRAKRAALQLNNKLVESHTIPFAVRDFIAACGGRTNFVSLRTSPTQLIVSFAKPELVQIAALQKLGIKGINKSQNQYRFVLGNFVNQLKQQIENER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details