Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA)

This Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA) spans the amino acid sequence from region 2-121.

Product Specifications

Product Name Alternative

Protransforming growth factor alpha, Cleaved into the following chain:, 1. Transforming growth factor alpha, 2. TGF-alpha, EGF-like TGF, ETGF, TGF type 1

UniProt

P55244

Expression Region

2-121

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WFDC2 Pre-designed siRNA Set B
SI018239B 1 Each

Human WFDC2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SYK
MBS8528583-01 0.1 mL

Mouse Monoclonal Antibody to SYK

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SYK
MBS8528583-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to SYK

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SYK
MBS8528583-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to SYK

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SYK
MBS8528583-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to SYK

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SYK
MBS8528583-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to SYK

Sign In for Pricing
View Details