Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA)

This Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA) spans the amino acid sequence from region 2-121.

Product Specifications

Product Name Alternative

Protransforming growth factor alpha, Cleaved into the following chain:, 1. Transforming growth factor alpha, 2. TGF-alpha, EGF-like TGF, ETGF, TGF type 1

UniProt

P55244

Expression Region

2-121

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vmn1r170 (NM_001166722) AAV Particle
MR221371A1V 250 µL

Mouse Vmn1r170 (NM_001166722) AAV Particle

Sign In for Pricing
View Details
Bismuth Subgallate Extrapure
00434 00500 500 g

Bismuth Subgallate Extrapure

Sign In for Pricing
View Details
HOXD1 antibody - C-terminal region (ARP32644_P050)
ARP32644_P050 100 µL

HOXD1 antibody - C-terminal region (ARP32644_P050)

Sign In for Pricing
View Details
PHKG1 Human shRNA Lentiviral Particle (Locus ID 5260)
TL310452V 500 µL Each

PHKG1 Human shRNA Lentiviral Particle (Locus ID 5260)

Sign In for Pricing
View Details
Rabbit Polyclonal Ancient ubiquitous protein 1 Antibody [Biotin]
NBP1-49916B 0.1 mL

Rabbit Polyclonal Ancient ubiquitous protein 1 Antibody [Biotin]

Sign In for Pricing
View Details
LentimiRa-hsa-miR-4725-3p Vector
mh41986 500 ng

LentimiRa-hsa-miR-4725-3p Vector

Sign In for Pricing
View Details