Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor activity-modifying protein 3 (RAMP3)

This Recombinant Human Receptor activity-modifying protein 3 (RAMP3) spans the amino acid sequence from region 24-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcitonin-receptor-like receptor activity-modifying protein 3 (CRLR activity-modifying protein 3)

UniProt

O60896

Expression Region

24-148aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ChoKB Lentiviral Activation Particles (h)
sc-409168-LAC 200 µL

ChoKB Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Anti-TIMP1 Antibody Picoband® (Dylight594 Conjugate)
A00561-Dylight594 100 µg

Anti-TIMP1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit
AE63240MO-01 48 Tests

Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit
AE63240MO-02 96 Tests

Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal DOC2B Antibody
NBP2-13930 0.1 mL

Rabbit Polyclonal DOC2B Antibody

Sign In for Pricing
View Details
Penconazole
CS-T-60194 1 Each

Penconazole

Sign In for Pricing
View Details