Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor activity-modifying protein 3 (RAMP3)

This Recombinant Human Receptor activity-modifying protein 3 (RAMP3) spans the amino acid sequence from region 24-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcitonin-receptor-like receptor activity-modifying protein 3 (CRLR activity-modifying protein 3)

UniProt

O60896

Expression Region

24-148aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-[ (4-Bromophenyl) methyl]-1H-1,2,4-triazol-3-amine
UQB15005-01 100 mg

1-[ (4-Bromophenyl) methyl]-1H-1,2,4-triazol-3-amine

Sign In for Pricing
View Details
1-[ (4-Bromophenyl) methyl]-1H-1,2,4-triazol-3-amine
UQB15005-02 1 g

1-[ (4-Bromophenyl) methyl]-1H-1,2,4-triazol-3-amine

Sign In for Pricing
View Details
ICOS, Human BioAssayTM ELISA Development Kit (AILIM, CD278, CRP-1)
167660 1 Kit

ICOS, Human BioAssayTM ELISA Development Kit (AILIM, CD278, CRP-1)

Sign In for Pricing
View Details
Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
TRV-0034008-01 20 µL

Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
TRV-0034008-02 100 µL

Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
TRV-0034008-03 200 µL

Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details