Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor activity-modifying protein 2 (RAMP2)

This Recombinant Human Receptor activity-modifying protein 2 (RAMP2) spans the amino acid sequence from region 43-175.

Product Specifications

Product Name Alternative

Receptor activity-modifying protein 2, Calcitonin-receptor-like receptor activity-modifying protein 2, CRLR activity-modifying protein 2

UniProt

O60895

Expression Region

43-175

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUSTN1 siRNA (Human)
MBS8237630-01 15 nmol

MUSTN1 siRNA (Human)

Sign In for Pricing
View Details
MUSTN1 siRNA (Human)
MBS8237630-02 30 nmol

MUSTN1 siRNA (Human)

Sign In for Pricing
View Details
MUSTN1 siRNA (Human)
MBS8237630-03 5x 30 nmol

MUSTN1 siRNA (Human)

Sign In for Pricing
View Details
TRAPPC4 CRISPR Activation Plasmid (m)
sc-425621-ACT 20 µg

TRAPPC4 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
JAK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1109707 1.0 µg DNA

JAK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Ig, Human ads Antibody : FITC
OASB01441-1MG 1 mg

Mouse Ig, Human ads Antibody : FITC

Sign In for Pricing
View Details