Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor activity-modifying protein 2 (RAMP2)

This Recombinant Human Receptor activity-modifying protein 2 (RAMP2) spans the amino acid sequence from region 43-175.

Product Specifications

Product Name Alternative

Receptor activity-modifying protein 2, Calcitonin-receptor-like receptor activity-modifying protein 2, CRLR activity-modifying protein 2

UniProt

O60895

Expression Region

43-175

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6134R-BF594-01 20 µL

WNT4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
WNT4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6134R-BF594-02 100 µL

WNT4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RPL21P7 3'UTR Lenti-reporter-Luc Vector
41075081 1.0 µg

RPL21P7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Eukaryotic Translation Elongation Factor 1 Delta Human (Recombinant)
22060972-1 2 μg

Eukaryotic Translation Elongation Factor 1 Delta Human (Recombinant)

Sign In for Pricing
View Details
Mouse Map2k6 Antibody (N-term)
E45R04070G-4 50 µL

Mouse Map2k6 Antibody (N-term)

Sign In for Pricing
View Details
VTCN1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2622102 1.0 µg DNA

VTCN1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details