Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor activity-modifying protein 2 (RAMP2)

This Recombinant Human Receptor activity-modifying protein 2 (RAMP2) spans the amino acid sequence from region 43-175.

Product Specifications

Product Name Alternative

Receptor activity-modifying protein 2, Calcitonin-receptor-like receptor activity-modifying protein 2, CRLR activity-modifying protein 2

UniProt

O60895

Expression Region

43-175

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Junctophilin 3, ID (Junctophilin-3, Junctophilin Type 3, JP-3, Jph3, Jp3) (APC)
MBS6483987-01 0.2 mL

Junctophilin 3, ID (Junctophilin-3, Junctophilin Type 3, JP-3, Jph3, Jp3) (APC)

Sign In for Pricing
View Details
Junctophilin 3, ID (Junctophilin-3, Junctophilin Type 3, JP-3, Jph3, Jp3) (APC)
MBS6483987-02 5x 0.2 mL

Junctophilin 3, ID (Junctophilin-3, Junctophilin Type 3, JP-3, Jph3, Jp3) (APC)

Sign In for Pricing
View Details
PPFIA3 Protein Lysate
OCOA13496-20UG 20 µg

PPFIA3 Protein Lysate

Sign In for Pricing
View Details
3110001D03Rik shRNA (m) Lentiviral Particles
sc-108892-V 200 µL

3110001D03Rik shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Clec9a sgRNA CRISPR Lentivector set (Mouse)
K3755301 3x 1.0 µg

Clec9a sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human A Disintegrin and Metalloproteinase with Thrombospondin Motifs 8,ADAMTS8 ELISA KIT
JOT-EK3481Hu 96 wells

Human A Disintegrin and Metalloproteinase with Thrombospondin Motifs 8,ADAMTS8 ELISA KIT

Sign In for Pricing
View Details