Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 89 (TMEM89)

This Recombinant Human Transmembrane protein 89 (TMEM89) spans the amino acid sequence from region 25-159.

Product Specifications

Product Name Alternative

Transmembrane protein 89

UniProt

A2RUT3

Expression Region

25-159

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHPQVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG2 (NM_001172432) Human Over-expression Lysate
LC432959 20 µg

PHKG2 (NM_001172432) Human Over-expression Lysate

Sign In for Pricing
View Details
Chartreusin
TRC-C291848-1MG 1 mg

Chartreusin

Sign In for Pricing
View Details
Human CD207, C-Flag Tag
HA210802-01 20 µg

Human CD207, C-Flag Tag

Sign In for Pricing
View Details
Human CD207, C-Flag Tag
HA210802-02 50 µg

Human CD207, C-Flag Tag

Sign In for Pricing
View Details
Human CD207, C-Flag Tag
HA210802-03 100 µg

Human CD207, C-Flag Tag

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL
BNC681059-500 1x 500 µL

CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details