Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-associated membrane protein 4 (Vamp4)

This Recombinant Mouse Vesicle-associated membrane protein 4 (Vamp4) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Vesicle-associated membrane protein 4, VAMP-4

UniProt

O70480

Expression Region

1-141

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®640R MTS
#92096 1x 1 mg

CF®640R MTS

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL
BNC681530-100 1x 100 µL

Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-13S 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
IFluor® 568 Tyramide
45106-AAT 200 Slides

IFluor® 568 Tyramide

Sign In for Pricing
View Details
Sodium Naphthalene-2,6-disulfonate
TRC-S646010-5G 5 g

Sodium Naphthalene-2,6-disulfonate

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-01 20 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details