Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-associated membrane protein 4 (Vamp4)

This Recombinant Mouse Vesicle-associated membrane protein 4 (Vamp4) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Vesicle-associated membrane protein 4, VAMP-4

UniProt

O70480

Expression Region

1-141

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amot Mouse Gene Knockout Kit (CRISPR)
KN501201 1 Kit

Amot Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011A-01 25 µg

Purified Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Purified Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011A-02 100 µg

Purified Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Benzocaine-d4
TRC-B197952-2.5MG 2.5 mg

Benzocaine-d4

Sign In for Pricing
View Details
Arhgef2 Sheep Polyclonal Antibody
AP05081PU-N 250 µg

Arhgef2 Sheep Polyclonal Antibody

Sign In for Pricing
View Details
S-(-)-Sulpiride
TRC-S689140-5G 5 g

S-(-)-Sulpiride

Sign In for Pricing
View Details