Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Amphiregulin (Areg)

This Recombinant Rat Amphiregulin (Areg) spans the amino acid sequence from region 97-243.

Product Specifications

Product Name Alternative

Amphiregulin AR Schwannoma-derived growth factor SDGF

UniProt

P24338

Expression Region

97-243

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3-Diphenylpropanol
TRC-D492768-500MG 500 mg

3,3-Diphenylpropanol

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL
BNC681143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)
PKSM040956-01 10 µg

Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)
PKSM040956-02 50 µg

Recombinant Mouse Cathepsin B/CTSB Protein (His Tag)

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), Biotin conjugate, 0.1mg/mL
BNCB0901-500 1x 500 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF640R conjugate, 0.1mg/mL
BNC401482-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details