Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Amphiregulin (Areg)

This Recombinant Rat Amphiregulin (Areg) spans the amino acid sequence from region 97-243.

Product Specifications

Product Name Alternative

Amphiregulin AR Schwannoma-derived growth factor SDGF

UniProt

P24338

Expression Region

97-243

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

stabilin1 (STAB1) Human Gene Knockout Kit (CRISPR)
KN415389 1 Kit

stabilin1 (STAB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-6803
BCAJ-6803 1 Unit

CO2 Incubator Air Jacketed BCAJ-6803

Sign In for Pricing
View Details
C-Met Recombinant Rabbit monoclonal Antibody
HA750594 100 µL

C-Met Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2-(2,3-Dihydro-1,3-dioxo-1H-inden-2-yl)-6-quinolinesulfonic Acid Sodium Salt
TRC-D848640-250MG 250 mg

2-(2,3-Dihydro-1,3-dioxo-1H-inden-2-yl)-6-quinolinesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS642359 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
TFIIS (TCEA2) (NM_003195) Human Over-expression Lysate
LY418837 100 µg

TFIIS (TCEA2) (NM_003195) Human Over-expression Lysate

Sign In for Pricing
View Details