Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translocon-associated protein subunit delta (SSR4)

This Recombinant Human Translocon-associated protein subunit delta (SSR4) spans the amino acid sequence from region 24-173.

Product Specifications

Product Name Alternative

Translocon-associated protein subunit delta, TRAP-delta, Signal sequence receptor subunit delta, SSR-delta

UniProt

P51571

Expression Region

24-173

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS700179 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562288 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
SETDB2 (NM_001160308) Human Over-expression Lysate
LY432029 100 µg

SETDB2 (NM_001160308) Human Over-expression Lysate

Sign In for Pricing
View Details
(1Alpha,3Beta,9Beta)-Cholesta-5,7-diene-1,3,25-triol
TRC-C431410-5MG 5 mg

(1Alpha,3Beta,9Beta)-Cholesta-5,7-diene-1,3,25-triol

Sign In for Pricing
View Details
CHD4 Recombinant Rabbit Monoclonal Antibody [JA33-40]
ET1704-53 100 µL

CHD4 Recombinant Rabbit Monoclonal Antibody [JA33-40]

Sign In for Pricing
View Details
ASAH1 Recombinant Rabbit Monoclonal Antibody [PSH07-71]
HA722887 100 µL

ASAH1 Recombinant Rabbit Monoclonal Antibody [PSH07-71]

Sign In for Pricing
View Details