Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translocon-associated protein subunit delta (SSR4)

This Recombinant Human Translocon-associated protein subunit delta (SSR4) spans the amino acid sequence from region 24-173.

Product Specifications

Product Name Alternative

Translocon-associated protein subunit delta, TRAP-delta, Signal sequence receptor subunit delta, SSR-delta

UniProt

P51571

Expression Region

24-173

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561426 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
HDAC9 Mouse Monoclonal Antibody [Clone ID: OTI6G4]
CF805309 100 µg

HDAC9 Mouse Monoclonal Antibody [Clone ID: OTI6G4]

Sign In for Pricing
View Details
Thiane
TRC-T344145-5G 5 g

Thiane

Sign In for Pricing
View Details
RPS6 Mouse Monoclonal Antibody [Clone ID: 7B10-E11-E11]
TA385181 100 µL

RPS6 Mouse Monoclonal Antibody [Clone ID: 7B10-E11-E11]

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Green, FITC)
E-CK-A370-01 50 Assays

E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Green, FITC)

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Green, FITC)
E-CK-A370-02 200 Assays

E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Green, FITC)

Sign In for Pricing
View Details