Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d)
This Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d) spans the amino acid sequence from region 22-173.
Product Specifications
Product Name Alternative
T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, CD_antigen= CD3d
UniProt
P04235
Expression Region
22-173
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
145114 100 µg
CYP19A1 (r.CYP19A1, CYP19, Arom, ARO, ARO1, Aromatase, CYPXIX, Cytochrome P-450AROM, Estrogen synthasearomatase, CPV1, CYAR, P-450AROM, cytochrome P450, subfamily XIX (aromatization of androgens) ) discontinued
Sign In for Pricing
View Details MBS520119-01 0.2 mg
Anti-Mouse CD4 Purified (Clone CT-CD4) (rat IgG2a)
Sign In for Pricing
View Details MBS520119-02 5x 0.2 mg
Anti-Mouse CD4 Purified (Clone CT-CD4) (rat IgG2a)
Sign In for Pricing
View Details