Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polynucleobacter sp. ATP synthase subunit b (atpF)

This Recombinant Polynucleobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4SUT0

Expression Region

1-156

Origin

Polynucleobacter sp. (strain QLW-P1DMWA-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELTKARQEGVQRVAEAEKRAQMSADEIRANAQAEAARIITQAKQDADQQVTSAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heptafluorobutyranilide-d5
TRC-H281059-10MG 10 mg

Heptafluorobutyranilide-d5

Sign In for Pricing
View Details
Rat Ferrochelatase (FECH) ELISA Kit
RDR-FECH-Ra-01 96 Tests

Rat Ferrochelatase (FECH) ELISA Kit

Sign In for Pricing
View Details
Rat Ferrochelatase (FECH) ELISA Kit
RDR-FECH-Ra-02 48 Tests

Rat Ferrochelatase (FECH) ELISA Kit

Sign In for Pricing
View Details
2-Bromo-1-cyclopropylethanone
TRC-B682710-5G 5 g

2-Bromo-1-cyclopropylethanone

Sign In for Pricing
View Details
Uncoated Human ANXA1 (Annexin A1) ELISA Kit
E-UNEL-H0122-01 5x 96 Tests

Uncoated Human ANXA1 (Annexin A1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human ANXA1 (Annexin A1) ELISA Kit
E-UNEL-H0122-02 15x 96 Tests

Uncoated Human ANXA1 (Annexin A1) ELISA Kit

Sign In for Pricing
View Details