Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polynucleobacter necessarius ATP synthase subunit b (atpF)

This Recombinant Polynucleobacter necessarius ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1XSD0

Expression Region

1-156

Origin

Polynucleobacter necessarius (strain STIR1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELNKARQEGVQRVAEAEKRAQMSAEEIRANAQAEAARVISQAQQDAAQQVTRAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Goat Polyclonal Antibody
AB1097-200 600 µg

CD19 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate
LC424862 20 µg

Integrin beta 4 (ITGB4) (NM_000213) Human Over-expression Lysate

Sign In for Pricing
View Details
PRKAR1B (NM_001164758) Human Recombinant Protein
TP328859L 1 mg

PRKAR1B (NM_001164758) Human Recombinant Protein

Sign In for Pricing
View Details
RTL4 (NM_001004308) Human Over-expression Lysate
LY424084 100 µg

RTL4 (NM_001004308) Human Over-expression Lysate

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF640R conjugate, 0.1mg/mL
BNC400970-500 1x 500 µL

GLG1 (Golgi Complex) (GLG1/970), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LILRA3 activation kit by CRISPRa
GA107576 1 Kit

Human LILRA3 activation kit by CRISPRa

Sign In for Pricing
View Details